Deqani-ks Forum - Welcome

Mire se vini ne Deqani-ks Forum, Ju ftojme qe te Regjistroheni, ne menyre qe te keni aksese ne te gjitha kategorit dhe temat, ne Deqani-ks Forum, mund te gjeni Shoqeri, Filma Shqip dhe te huaj, Muziken me te re 2011, DVD Humore shqip, Keshilla Mjeksore, Diskutime, Video Klipe, Kuriozitete, dhe Lajmet me te reja nga vendi dhe bota.

* A e DiNi Se.........?*

Shko poshtë

* A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:00 am

Per peshkun trashanik ?Siluris Glanis?- shkenc?tar?t dol?n n? p?rfundimin se pavar?sisht kok?s s? madhe, ?sht? peshku m? budalla n? bot?, sepse n? pranver? kur b?n nxeht?, n? breg t? lumit rriten shelgjet dhe n? uj? bien thuprat e k?tij druri s? bashku me gjethet; peshku trashanik me ngut i p?rpin duke menduar se bie ushqimi i tij i preferuar. N? stomak k?to fije t? shelgut l?shojn? alkool q? e ngordh peshkun.

Malet m? t? larta n? Ballkan jan? Alpet Shqiptare dhe kan? 13 maja me mbi 2.500 metra lart?si dhe sip?rfaqe 2.240 km?.

Rruga m? e vjet?r n? Ballkan ka qen? ?Via Egnatia? (Via Egnacia).

Njeriu m? i gjat? n? bot? ka qen? 2.72 metra.

N? trupin e njeriut ka rreth 656 muskuj. Disa prej tyre jane 38 cm, e disa mezi arrijne nje milimet?r.

Maja me e larte ne bote eshte Mount Everest me 8882 m, gjendet ne Nepal.

Flutura m? e madhe n? bot? ?sht? 270 centimetra katror.

Qeliza u zbulua p?r her? t? par? nga shkenc?tari anglez Robert Hooke me 1665 i cili i dha edhe emrin. Ky ?sht? zbulimi m? i madh n? mjek?si, sepse qeliza ?sht? nj?sia themelore kryesore e ?do organizmi t? gjall?.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:00 am

Novob?rda ?sht? quajtur Mali I Argjentit e m? von? Kodra e Re e cila ra n?n sundimin osman m? 1455.

Maja e Korabit ?sht? maja m? e lart? n? Shqip?ri.

Romani I par? shqiptar ?sht? ?Marcja? I Ndoc Nikajt I botuar n? vitin 1899.

N? vitin 1530 Prishtina kishte 12 lagje, prej tyre 9 t? krishtera katolike shqiptare dhe vetem 3 muslimane. Sot ?sht? qyteti m? I madh n? Kosov?, p?rkat?sisht kryeqytet.

Piktori venecian Marco Basaiti q? pikturoi rreth viteve 1500-1530, ka qen? me prejardhje shqiptare.

N? qytetin e Amalfit n? Kampani n? kish?n kryesore t? k?tij qyteti, n? vitin
1506 ngritet p?rmendorja e varrit t? perbashk?t t? familj?s s? Sk?nderbeut me nj? shqiponj? dykrenare shqiptare.

Katund quhen disa fshat?ra n? Dalmaci. Gati n? t? gjith? qytetet e Dalmacis? nga nj? rruge mban emrin ?Rruga Ilire?.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:00 am

Ishulli m? i madh ?sht? n? Atlantikun Verior me 2.6 milion km?.

Gjaku n? organizmin e njeriut udh?ton shum? shpejt: prej zemr?s deri te gisht?rinjt? e k?mb?s arrin p?r 16 sekonda, deri n? tru p?r 8s, deri n? mushk?ri vet?m p?r 6 s.

M? 1592 Galileu Galileo zbuloi termometrin e par?, mir?po termometri me i p?rshtatsh?m u punua n? Itali m? 1654.

M? 1628 shkenc?tari V. Harvej nga Anglia i pari dha shpjegimin mbi qarkullimin e gjakut n? trupin e njeriut.

N? Turqi gjendet nj? skulptur?, vep?r e natyr?s, q? paraqitet nj? grua duke qar?. Lot?t e saj rrjedhin me shekuj, por nga burimet e fshehta t? ujit q? ndodhen n?n shk?mb.

Mali m? i lart? n? Kosov? ?sht? Gjeravica me 2.656 m lart?si.

Xhejson Pitri nga Mexburgu (SHBA), plot 13 vite nuk b?ri asnj? munges? n? shkoll?.

Helmi i Meduz?s mund ta mbys? njeriun n?se ?sht? n? sasi t? m?dha, nd?rsa shkenc?tar?t prej tij po perpiqen t? nxjerrin ila?in p?r sh?rimin e s?mundjes s? zemr?s.

Tomas Jang, fizikant nga shekulli XVIII-t? fliste dymb?dhjet? gjuh? kur ishte vet?m tet? vje?.

Gjat? nd?rtimit t? kanalit t? Panamas? kan? humbur jet?n m? tep?r se 25 mij? njer?z.

Masa e virusit ndaj mas?s s? njeriut mesatar ?sht? proporcionale me mas?n e njeriut ndaj mas?s s? Tok?s.

Xhirafa ?sht? e vetmja kafsh? e cila mund t? dalloje ngjyrat, sepse syri i saj ?sht? p?raf?rsisht i nj?jt? me syrin e njeriut.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:01 am

N? tok? ekzistojn? 4 oqeane dhe 56 dete q? s? bashku formojn? ?Detin Bot?ror? i cili p?rfshin 71% t? sip?rfaq?s s? p?rgjithshme t? tok?s (316 mil.km2)

P?r nga sasia e krip?s m? shum? ka Deti i Kuq nd?sa m? pak Deti Baltik

Oqeani m? i madh ?sht? Oqeani i Qet?, pastaj Oqeani Atlantik, Oqeani Indian dhe Oqeani i Ngrir? i Veriut.

Lumi Amazona ?sht? i vetmi lum? q? nuk ka t? nd?rtuar asnj? ur? mbi t?.

N? Evrop? patatja ?sht? sjell? nga Amerika n? vitin 1536. N? fillim e mbillnin p?r shkak t? lules s? bukur q? ka, kurse m? von? filluan ta p?rdorin p?r ushqim.

Peshku ?Pegava? ?sht? nj? lloj ngjale q? mund t? q?ndroj? v?rtikalisht. Kur peshkon, ajo ngrihet, kurse me bishtin p?rforcohet mbi shk?mb ose ndonj? trup tjet?r.

Gjethet m? t? m?dha i ka nj? lloj pallme e quajtur ?Rafia?, rritet n? brigjet e lumit Amazon. Gjethet e saj t? blerta arrijn? nj? gjat?si deri 22 metra dhe gjer?si af?rsisht 12 metra, kurse bishtin e gjeth?s e ka 5 metra t? gjat?. Nj? gjethe e till? mund t? strehoj? 10 njer?z.

N? Brazil gjat? shek. XX-t? ?sht? vrar? gjarpri m? i madh n? bot?, anakonda, gjat?sia e t? cilit arrinte ne 35 metra. P?r ta vrar? k?t? gjigant u desh q? t? goditej me 500 plumba.

Druri i cili e mban rekordin e tarsh?sis? n? bot? ?sht? baobabi, i cili gjendet n? Tanganik? me mosh? rreth 30 shekuj. Ky dru perimetrin e trungut e ka 47 m, lartesin? 22 metra, nd?rsa perimetrin e kuror?s 145 metra.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:01 am

M? 1560 kirurgu francez Ambruaz Pare b?ri i pari gjymtyr? artificiale t? njeriut.

M? 1590 holandezi Zaharijaz Jansen q? merrej me optik?, konstruktoi mikroskopin.

N? vitin 1790 n? Amerik? ?sht? shpikur turjela e par? p?r shpuarjen e dh?mb?ve.

Lumi m? i gjat? n? bot? ?sht? Nili me gjat?si 6.671 km. q? gjendet n? Afrik?.

Kina ?sht? shteti m? i madh n? bot? me 1.221,692,000 banor?. N? Mesjet? quhej Katai.

Gjarpri i ujit q? jeton n? veriper?ndim t? Australis? rreth shk?mbinjve t? ujit, ?sht? kafsha m? helmuese n? bot?. Helmi i tij ?sht? 100 her? m? i fort? se helmi i gjarprit australian n? tok? i quajtur ?Tapana e Shkret?tir?s? e q? konsiderohet gjarpri m? helmues tok?sor.

Rusia ?sht? shteti m? i madh p?r nga sip?rfaqja me 17.075,000 km?

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:01 am

Uj?vara m? e madhe n? Bot? ?sht? ?Engj?l? e lumit Karao (Venezuel?). Lart?sia nga e cila bie uji ?sht? 1.000 m. Kjo uj?var? ?sht? vet?m nj? nga shum? uj?varat e larta n? k?to an? te Venezuel?s. Emrin e ka marr? sipas pilotit amerikan Xhimi Engj?l i cili n? vitin 1933 e ka vizituar dhe vendosur n? ditarin e tij.
Uj?vara e dyt? ?sht? n? Republik?n Jugafrikane me lart?si 414 m.
Uj?vara e tret? ?sht? ?Kukenani? n? Venezuel? me 610 m, lart?si.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:01 am

N? Dit?n e N?nave n? SHBA b?hen m? tep?r telefonata personale se n?
?do dit? tjet?r n? ?do shtet tjet?r.

Megjith?se n? bot? ka m? shum? se 600 milion?telefona, gjysma e bot?s
ende nuk ka b?r? asnj? telefonat?.

Gjysma e popullsis? s? bot?s fiton vet?m rreth 5% t? pasuris? n? bot?.

N? 1750 n? bot? jetonin rreth 800 milion? njer?z, n?1850 nje miliard? m? tep?r dhe n? nj? 1950 edhe nj?tjet?r miliard m? tep?r. Mastaj u desh?n vet?m 50 vjet p?r tu dyfishuar dmth. 6 miliard?

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:02 am

N? Rom?n Antike veza gjendej vet?m n? tavolinat m? t? r?nd?sishme dhe ruhej vet?m p?r miqt? m? t? r?nd?sish?m.

N? Egjypt veza konsiderohej nj? privilegj dhe monopol i faraon?ve, sac?rdot?ve dhe shtresave t? larta t? shoq?ris?.

Qytet?rimet antike, egjiptian?t, persian?t, grek?t e romak?t, e kan? kuptuar mjaft mir? se veza e pul?s ?sht? burim energjie dhe vlerash t? pap?rs?ritshme ushqimore.

N? bot? veza konsiderohet si ushqimi q? ka furnizuar p?r shekuj me radh? protein?n m? t? mir? me origjin? shtazore dhe si ushqimin q? ka shp?tuar popuj t? t?r? nga rreziku i t? mosushqyerit ose t? ushqyerit t? keq.
Persian?t kishin nj? ritual t? p?rhersh?m q? konsiston n? k?mbimin e vez?ve si shenj? e fillimit t? pranver?s. Arsyeja e k?tij rituali q?ndron n? besimin se veza ?sht? embrioni i jet?s. (rikthimi i bot?s n? jet? pas nd?rprerjes letargjike gjat? dimrit)

E nj?jta gj? sot p?rdoret gjat? pashk?ve kristiane t? cilat jo rast?sisht jan? n? pranver? pasi japin kuptimin thell? t? rikthimit n? jet?. (p?rplasja e vez?ve t? lyera)

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:02 am

P?r t? prodhuar 1 kg. mjalt? blet?s i duhet t? thith? nektarin e 12 milion luleve duke b?r? rreth 300 000 kilomet?r fluturim.

Luft?rat dhe statistikat:Nga 1618 m? 1905 jan? b?r? 1044 luft?ra tok?sore,122 betejadetare,490 rrethime,44 kapitullime.Lufta m? e gjat? llogaritet midis Venecas dhe Turqis? (55 vjet) n? vitet 1644-1699, kuse lufta m? e shkurt? ?sht? ajo midis Austris? dhe Italis? e cila zgjati vet?m 6 or?.

zogu nuk ka shqis?n e t? nuhaturit dhe t? shijes.

Qukapiku n? dit? han mesatarisht 3000 insekte.

Nga barku i vajz?s 20 vje?are nga Devoni Jugor,Angli u nxor "topi" nga qimet e flok?ve te saj t? cilat i kishte g?lltitur,i r?nd? 2,5 kg.Operimi u realizua n? mars 1985.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:02 am

Shtate mrekullite e botes moderne.

Empire state building.Ndertesa me e larte ne bote u hap me 1 maj 1931 eshte i larte 448m.

Itaipu Dam eshte hidrocentrali qe bashkon Brazilin me Paraguain ka 7.7km dhe prodhon 75 milion megawatt ore elektricitet.

Kulla me e larte ne bote eshte CN TOWER ne Toronto te Kanadase qendron 553.34m ne lartesi.

Kanali i panamase eshte me i gjati dhe bashkon detin e Karaibeve me oqeanin Pacifik eshte hapur ne Gusht te 1914.Mbi 27000 puntore mendohet te kene gjetur vdekjen gjate ndertimit.

Tuneli i Kanalit(Channel Tunnel) dy 50km tunele trenash 7.6m te gjere se cili u hapen ne 1994 per te bashkuar Angline me Francen

Mbrojtsja nga DETI I VERIUT ka filluar ne vitin 1923 kjo porte madheshtore mbrojtese u ndertua per te luftuar Forcat natyrore qe i paraqiten Hollandes.

Ura e florinjte ne San Francisco Bay me e gjata dhe me e larta.Shtyllat mbajtese jane 227m,ka nje pamje te mrekullueshme ne Gjirin e San Franciskos ne Kaliforni.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:02 am

Shtate mrekullite e botes se lashte

Tempulli i Artemises

Tempulli i Artemises ose i Dianes ishte ndertuar ne vitin 350para krishtit
ne Efesus te Turqise,por u shkaterua ne 262pas krishtit nga Gothet.

Gjigandi i Rodit

35metra i larte statuja e Helios(Apollos)u krijua ne 292-280para krishtit qendronte madheshtor ne hyrje te Rodit,u shkaterua nga nje termet ne vitin 224pk.

Muzeu i mbret Mausolus

Varri i mbretit te Halikarnasus tani Bodrum ne Turqi u ndertua ne vitin

Fanari i Faros

I pari fanar ishte ndertuar ne vitin 270PKne ishullin e Faros ne gjirin e Egjyptit dhe qendronte 122m i larte U shemb gjate nje termeti ne vitin 1375.

Statuja e Zeusit

Skulptori Fidias krijoi 12m statuje me flori,mermer dhe fildish statuje te Zeusit(Jupiterit)ne Olimp te Greqise ne vitin 450PK.Me vone u transportua ne Stamboll ku me vone u shkaterua nga zjarri.

Kopshtet e varura te Babilonise

Asnje gjurme nuk ka mbetur nga Kopshtet e varura te Semiramise ne Babiloni tani Irak. Ishin ndertuar ne vitin 600 PK.

Piramida e Gizes

Piramida e Gizes ne Egjypt ishte ndertuar nga tre 4rt Dinastite e faraoneve te Egjyptit.Piramida madheshtore (Horizonti i Kufus) u ndertua ne vitin 2550PK dhe qendronte 146.6m e larte.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:02 am

Mushkonja me vdekjeprurese.

Parazitet e malaries qe jane ne mushkonjen Anopheles kane qene shkaku kryesor i 50%te vdekjeve humane qe ne Epoken e Gurit(perjashtuar lufterat dhe aksidentet)Cdo vit veten ne Afrike, 1.4miljon-2.8miljon njerez vdesin nga malaria....dhe e gjithe kjo vetem nga nje mushkonje 3mm e gjate.

Fataliteti me i madh nga sulmi i krokodilave.

Me 19 shkurt,1945 nje ushtri japoneze ishte detyruar te kalonte 16km ne nje ishull me laguna te quajtur Burmese(tani Myanmar)Lagunat ishin shtepi e krokodilave te ujrave te kripura(crocodylus porosus)te cilet rriten deri ne 4.5m .Deri ne mengjes nga 10.000 ushtare qe hyn ne lagunat vetem 20 kishin shpetuar.

Fataliteti me i madh i rrufese kundrejt lopeve ka ndodhur ne nje ferme ne New South Wales te Australise ku 68 xherzi lope ishin strehuar nder nje peme.Ne peme kishte rene rrufeja dhe te gjithe kafshet kishin ngordhur.

Bima me ere me te forte

E njohur si lule kufome(amorphophallus titanium)ose titan arum eshte lulja me ere me te forte ne planetin tone.Kur lulezon era e saj krahasohet me eren e nje kufome ose me mishin e qelbur dhe mund te diktohet per 0.8km larg.Eshte zbuluar ne 1878 ne Sumatran.

Paraziti me i gjate

Diphylloborithium latum ose ndryshe shiriti i peshkut eshte gjetur me shume ne zorret e peshqve dhe ne disa raste tek njerezit.Ai eshte i gjate prej 9-18 m gati sa nje autobus.

Akrepi me i rende

Afrikani i madh dhe i zi specie Pandinus imperator peshon 60gr dhe eshte 13-18cm i gjate afersisht sa dora e njeriut.

Merimanga me e rende

Ajo eshte nje zog ngrenese eshte gjetur ne Paramaribo,Surinam.Peshon rreth 122.2gr.


Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:03 am

-Njeriu m? i mo?em n? bot? n? historin e shkruar t? njerzimit ka qen? zonja Zhane Luisa Kalmenti (Jeanne Louise Calment) e lindur m? 21 shkurt 1875 n? Franc? e cila vdiq m? 4 gusht 1997.

Ajo n? jeten e saj ?sh? regjistruar n? librin e rekordeve p?r disa dukuri sikur q? ?sht? k?ng?tarja m? e vjet?r apo aktorja m? e vjet?r. N? mosh?n 114 vje?are ajo luajti rolin q? prezentonte vet?veten n? filmin "Vincenti dhe Un?" (Vincent and Me) n? vitin 1990.

-Krung-thep-maha-nakorn apo Krungthepmahanakornamornratanakosinma-hintarayutthayamahadilokphopnopparatraja-thaniburiromudomrajaniwesmahasatharnamo-rnphimarnavatarnsathitsakkattiyavisanukamprasit ?sht? emri zyrtar i Bankokut kryeqytetit t? Tailand?s. Nj?herit ky ?sht? toponimi m? i gjat? p?r ndonj? vend gjeografik.
Termi i toponimit p?rb?het nga 175 shkronja dhe nga shqiptar?t ?sh? v?shtir? t? lexohet nd?rsa tabela n? hymje t? qytetit duhej t? dukej p?raf?rsisht:


-Zsofie Gyamati ?sht? nj? 19 vje?are (2006) q? p?r librin e rekordeve pohon se ja pasur or?n e m?simit m? t? gjat? n? bot?. Ajo thot? se ishte ora e m?simit t? gramatik?s dhe literatur?s s? hunarishtes.

Kjo ndodhi si ide e nj?rit nga sholk?t e klas?s pasi q? t? M?rkuren kishin dy or? t? gjata nj?ren pastjetres. Pasi q? atyre ju nevojitej t? ndiqnin dy leksionet nj?ri pas tjetrit, idea e shokut t? saj ishte q? t? studionin pand?rpre 24 or?. K?shtu ai aranzhoi k?t? or? m?simi n? gjimnaz?.

Regullat e k?saj ore m?simi ishin q? brenda 24 or?ve t? mos ket? nd?rpreje bisede, asnj?ri t? mos e zinte gjumi dhe nevoja biologjike duhej kryer brenda dy minutave. K?to tri rregulla kan? qen? nj?herit edhe "nj?si mat?se" q? duhej rrespektuar gjithsesi.

Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga No.i.d prej Sat Jul 03, 2010 9:03 am

T? domosdoshme p?r jet?n

Nga studimet mbi rruzullin tok?sor mund t? formohet leht? nj? list? mbi "ekuilibrat e element?ve t? domosdosh?m p?r jet?n". Astronomi amerikan Hjuxh Ros ka hartuar nj? list? n? lidhje me p?rshtatshm?rin? e Tok?s p?r jet?n duke i renditur si m? posht?:

Forca T?rheq?se e Tok?s

N?se do t? ishte m? e madhe, atmosfera e Tok?s do t? akumulonte sasi t? m?dha amoniaku dhe metani, t? cilat do t? ishin negative p?r jet?n.

N?se do t? ishte m? e vog?l, atmosfera e Tok?s do t? humbte sasira t? m?dha uji q? do ta b?nte t? pamundur jetes?n.

Larg?sia nga Dielli

N?se do t? ishte m? e madhe, planeti do t? ftohej shum?, duke krijuar efekte negative mbi qarkullimin e ujit n? atmosfer?, si pasoj? planeti do t? hynte n? epok?n e akullit.

N?se do t? ishte m? e vog?l, planeti do t? skuqej nga rrezet e Diellit duke shkaktuar efekte negative mbi qarkullimin e ujit n? atmosfer?, gj? q? do ta b?nte t? pamundur jetes?n n? t?.

Trash?sia e Kores s? Tok?s

N?se do t? ishte m? e madhe, do t? transportohej nga atmosfera p?r n? koren e Tok?s m? tep?r oksigjen.

N?se do t? ishte m? e vog?l, do t? kishte aq l?vizje vullkanike sa do ta b?nin t? pamundur jetes?n n? planet.

Shpejt?sia e Rrotullimit t? Tok?s rreth vetes

N?se do t? ishte m? e madhe, er?rat atmosferike do t? fitonin shpejt?si t? m?dha, tufanet dhe ciklonet do ta b?nin t? pamundur jetes?n.

N?se do t? ishte m? e vog?l, ndryshimi i temperatur?s midis dit?s dhe nat?s do t? ishte shum? i madh.

Forca T?rheq?se midis H?n?s

N?se do t? ishte m? e madhe, forca t?rheq?se e fuqishme e H?n?s do t? ndihej shum? efektive mbi kushtet atmosferike, rrotullimin e Tok?s rreth vetes dhe mbi baticat e zbaticat n? dete.

N?se do t? ishte m? e vog?l, do t? shkaktonte ndryshime negative t? klim?s p?r jet?n.

Fusha Magnetike e Tok?s

N?se do t? ishte m? e madhe, do t? formoheshin furtuna t? fuqishme elektromagnetike.

N?se do t? ishte m? e vog?l, do t? hiqej ajo mburoj? e Tok?s kundrejt er?rave t? Diellit dhe rrezatimit t? d?msh?m t? tij.

Albedo (Rrezet e Diellit q? reflektojn? n? sip?rfaqe t? Tok?s, p?rqindja e rrezeve t? Diellit q? arrijn? deri n? sip?rfaqe t? Tok?s)

N?se do t? ishin m? t? m?dha, me nj? shpejt?si t? rrufeshme do t? hynim n? epok?n e akullit.

N?se do t? ishin m? e vog?l, pasojat "ser?" do ta rrisnin shum? nxeht?sin? ku Toka fillimisht do t? mbetej posht? ujit nga shkrirja e akullnajave dhe m? pas do t? nxehej tej mase.

P?rqindja e Oksigjenit dhe e Azotit n? Atmosfer?

N?se do t? ishte m? e madhe, funksionet jet?sore do t? shpejt?soheshin negativisht.

N?se do t? ishte m? e vog?l, funksionet jet?sore do t? ngadal?soheshin negativisht.

P?rqindja e Ujit dhe Dioksidit t? Karbonit n? Atmosfer?

N?se do t? ishte m? e madhe, atmosfera do t? ngrohej tej mase.

N?se do t? ishte m? e vog?l, temperatura atmosferike do t? ulej.

Trash?sia e Shtres?s s? Ozonit

N?se do t? ishte m? e madhe, temperatura n? rruzullin tok?sor do t? ulej.

N?se do t? ishte m? e vog?l, rruzulli tok?sor do t? nxehej shum? dhe do t? mbetej i pambrojtur p?rball? rrezeve t? d?mshme ultravjollc? t? Diellit.

L?vizjet Sizmike (T?rmetet)

N?se do t? ishin m? t? m?dha, do t? ishte nj? shkat?rrim i vazhduesh?m p?r gjallesat.

N?se do t? ishin m? t? vogla, l?nd?t ushqimore n? fund t? oqeanit nuk do t? p?rziheshin n? uj?, gj? q? do t? ndikonte negativisht n? jet?n n? oqeane dhe dete, si rrjedhoj? edhe n? t? gjitha gjallesat e Tok?s.

K?to q? num?ruam deri k?tu jan? vet?m nj? pjes? e atyre ekuilibrave aq delikat? dhe t? domosdosh?m p?r t? formuar dhe mund?suar jet?n n? Tok?. Madje vet?m k?to q? u radhit?n k?tu do t? mjaftonin p?r t? demostruar se universi dhe Toka kurr? nuk mund t? arrijn? t? formohen si fryt i rast?sis? dhe i zhvillimit t? ngjarjeve aksidentale nj?ra pas tjetr?s.


Numri i postimeve : 2728
PIKE : 4556
Popullariteti Popullariteti : 82
Data e regjistrimit : 26/06/2010
Mosha : 25

Mbrapsht në krye Shko poshtë

Re: * A e DiNi Se.........?*

Mesazh nga Sponsored content

Sponsored content

Mbrapsht në krye Shko poshtë

Mbrapsht në krye

Drejtat e ktij Forumit:
Ju nuk mund ti përgjigjeni temave të këtij forumi